Transcript | Ll_transcript_483004 |
---|---|
CDS coordinates | 872-1372 (+) |
Peptide sequence | MDKGTPPSLFVNDGSFMERFKQLQQEQDKGKDAKLEESKPIKIVSGSLTSPSIRKANDTQKPSQSSSGGKLAFSLKQKSKLVPPPVKLADDDEEETDAGDVSNDAPLKRQKMGQEDGTEQSLRHLDVAPSSPSDPTVKKVADKLASFVAKNGRQFEDVTRQKNPGDT |
ORF Type | 3prime_partial |
Blastp | SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 58.19% of identity |
---|---|
Blastx | SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 58.96% of identity |
Eggnog | RNA splicing(ENOG410ZSH4) |
Kegg | Link to kegg annotations (AT3G52120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453415.1) |
Pfam | Surp module (PF01805.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer