Protein coding transcript 71163

• Transcript: Ll_transcript_483005
• CDS coordinates: 213-740 (+)
• Peptide sequence: MDKGPPPSLFVNDGSFLERFKRLQQEQEKGKNAKLEESKPVKVASGSLASNPSIRKANDTPKTPQAGSGGKLAFSLKQKSKLVPPPVNLADDDEEETGAGDASNDAPPKRQKLGQADGTEQSLRQLDVAYSTSTYQEWCIGTPATRVICIPLFMLLVLISFISDMQHLLLQVILQ*
• ORF Type: complete

Annotations of Ll_transcript_483005

• Blastp: SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 47.52% of identity
• Blastx: SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 48.15% of identity
• Eggnog: RNA splicing(ENOG410ZSH4)
• Kegg: Link to kegg annotations (AT3G52120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413451.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;