Protein coding transcript 71164

• Transcript: Ll_transcript_483006
• CDS coordinates: 190-690 (+)
• Peptide sequence: MDKGTPPSLFVNDGSFMERFKQLQQEQDKGKDAKLEESKPIKIVSGSLTSPSIRKANDTQKPSQSSSGGKLAFSLKQKSKLVPPPVKLADDDEEETDAGDVSNDAPLKRQKMGQEDGTEQSLRHLDVAPSSPSDPTVKKVADKLASFVAKNGRQFEDVTRQKNPGDT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_483006

• Blastp: SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 58.19% of identity
• Blastx: SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 58.96% of identity
• Eggnog: RNA splicing(ENOG410ZSH4)
• Kegg: Link to kegg annotations (AT3G52120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453415.1)
• Pfam: Surp module (PF01805.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;