Protein coding transcript 71165

• Transcript: Ll_transcript_483007
• CDS coordinates: 3413-3895 (+)
• Peptide sequence: MEFYMKRAAQEERSRRPKYSKDEMPPPASLQAASGKKGHHMGDYIPLEELEKFMATCNDAEAQKAAKEAAERAKIQADNVGHKLLSKMGWKEGEGLGSSRKGIADPIMAGSVKKDNLGVGAVQPGEVTPEDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY*
• ORF Type: complete

Annotations of Ll_transcript_483007

• Blastp: SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 80.84% of identity
• Blastx: SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 68.65% of identity
• Eggnog: RNA splicing(ENOG410ZSH4)
• Kegg: Link to kegg annotations (AT3G52120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413451.1)
• Pfam: G-patch domain (PF12656.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;