Protein coding transcript 71287

• Transcript: Ll_transcript_484277
• CDS coordinates: 882-1415 (+)
• Peptide sequence: MFTNDQRQQERTGKYGTPRLQYLQELVIQFQNTNDDETKEKILANLANFAYDPYNYNFLRQLNVLELFLDCMSEPSEKLVEFGVGGICNSCADPANAAIVTQCGGIPLIIQCLSSPVRNTVNSALGALYYVCNESNKDEVLKPEVVDLIKRYAAAEEVSLSFSNLARAFLDKHLSGN*
• ORF Type: complete

Annotations of Ll_transcript_484277

• Blastp: Armadillo repeat-containing protein 7 from Mus with 50.32% of identity
• Blastx: Armadillo repeat-containing protein 7 from Mus with 46.37% of identity
• Eggnog: NA(ENOG4111JC6)
• Kegg: Link to kegg annotations (276905)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423564.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;