| Transcript | Ll_transcript_484283 |
|---|---|
| CDS coordinates | 1231-1641 (+) |
| Peptide sequence | MFTNDQRQQERTGKYGTPRLQYLQELVIQFQNTNDDETKEKILANLANFAYDPYNYNFLRQLNVLELFLDCMSEPSEKLVEFGVGGICNSCADPANAAIVTQCGGIPLIIQCLSSPVRNTVRTITCLLALFIFVGS* |
| ORF Type | complete |
| Blastp | Armadillo repeat-containing protein 7 from Mus with 56.78% of identity |
|---|---|
| Blastx | Armadillo repeat-containing protein 7 from Mus with 56.78% of identity |
| Eggnog | NA(ENOG4111JC6) |
| Kegg | Link to kegg annotations (276905) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423564.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer