Protein coding transcript 71393

• Transcript: Ll_transcript_484569
• CDS coordinates: 58-552 (+)
• Peptide sequence: MTRKCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHYAGSNSPAVETTDHASADGYASEDFLPGSSSTSRERKRGVPWTEEEHRRFLLGLHKLGKGDWRGISRNYVISRTPTQVASHAQKYFIRQSNVSRRKRRSSLFDIVADEVCTLICKYYA*
• ORF Type: complete

Annotations of Ll_transcript_484569

• Blastp: Transcription factor KUA1 from Arabidopsis with 51.79% of identity
• Blastx: Transcription factor MYBS3 from Oryza sativa with 76.51% of identity
• Eggnog: Transcription factor(ENOG4111IMA)
• Kegg: Link to kegg annotations (AT5G47390)
• CantataDB: Link to cantataDB annotations (CNT0000425)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422882.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;