Protein coding transcript 71398

• Transcript: Ll_transcript_484563
• CDS coordinates: 58-423 (+)
• Peptide sequence: MTRKCSHCSHNGHNSRTCPNRGVKLFGVRLTDGSIRKSASMGNLSHYAGSNSPAVETTDHASADGYASEDFLPGSSSTSRERKRGFILHPMLHALFYFQFRAYSMFFLKLEKTSLFHKLLE*
• ORF Type: complete

Annotations of Ll_transcript_484563

• Blastp: Transcription factor KUA1 from Arabidopsis with 62.5% of identity
• Blastx: Transcription factor KUA1 from Arabidopsis with 62.5% of identity
• Eggnog: Transcription factor(ENOG4111IMA)
• Kegg: Link to kegg annotations (AT5G47390)
• CantataDB: Link to cantataDB annotations (CNT0000425)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422882.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;