Protein coding transcript 71427

• Transcript: Ll_transcript_482479
• CDS coordinates: 3-470 (+)
• Peptide sequence: VTCNNDDRVTRLDLGNSNLSGHLVPELGKLDHLQHLELYKNNIQGVIPPELGNLTDLLSMDLYNNNLSGTIPPSLGNLKNLEFLRLNDNRLTGPIPKELADLRNLKVLDLSNNNLCGTIPTSGPFEHIPLNNFENNPHLEGPELLGLVPYDTNCS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_482479

• Blastp: Leucine-rich repeat protein 1 from Arabidopsis with 76.13% of identity
• Blastx: Leucine-rich repeat protein 1 from Arabidopsis with 76.13% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G21090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455885.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;