Protein coding transcript 71511

• Transcript: Ll_transcript_484990
• CDS coordinates: 55-756 (+)
• Peptide sequence: MDHAELTTDQVLTRDIPWETYMSTKLISGTSLQLFRRYDHRPESVRAQLLDDDGPAYVQVFIHVLRDIHKEDTVEYVLALIDEMLSANPKRARLFHHSTLADEDTYEPFLRLLWKGNWFIQEKSCKILALILSARPKNQNGIVSNGEASNSKKPFSTIDDALIGLVKWLCEQLKKPSHPNRGVPTAVNCLSTILKEPVVRSSFVQADGVKLLVPLISPASNQQSIQVSLLDYI*
• ORF Type: complete

Annotations of Ll_transcript_484990

• Blastp: V-type proton ATPase subunit H from Arabidopsis with 73.57% of identity
• Blastx: V-type proton ATPase subunit H from Arabidopsis with 82.38% of identity
• Eggnog: subunit (H(COG5231)
• Kegg: Link to kegg annotations (AT3G42050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421164.1)
• Pfam: V-ATPase subunit H (PF03224.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;