Transcript | Ll_transcript_484149 |
---|---|
CDS coordinates | 614-1816 (+) |
Peptide sequence | MDTKLLEALYWKGLPVFDMGSHMSAIDVGWGSPTFHKMGREKVILINSMLPFGYELLMCDTDMVWLKNPLPYIAHYPEADVLTSSDQVVPTVVDDSLEVWEEVGAAYNIGIFHWRPTESAKKLAKEWKELLLADENIWDQNGFNDIVHRQLGPSVDDDSGLLYAYDGNLKLGILPASIFCSGHTYFVQAMHQQLRLEPYAVHTTFQYAGTAGKRHRLREAMLFYDPPEYYNPPGGFLSFKPSIPRSLLLNGNHTIGSHFTLINYQMRQIRTALAIASLLNRTLVMPPLWCKIDRLWFPHPGVLEGSMTRQPFLCPLDHVFEVNVMLKELPEEEFGPQIDIREYSILENSALPAEVKKSWLDVRLCKKGTKDCNASNNTTFGGALKFPKHSNEETFIEIFSS |
ORF Type | 3prime_partial |
Blastp | Arabinosyltransferase XEG113 from Arabidopsis with 81.3% of identity |
---|---|
Blastx | Arabinosyltransferase XEG113 from Arabidopsis with 80.68% of identity |
Eggnog | Nucleotide-diphospho-sugar transferase(ENOG410ZPDM) |
Kegg | Link to kegg annotations (AT2G35610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445117.1) |
Pfam | Nucleotide-diphospho-sugar transferase (PF03407.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer