Protein coding transcript 71548

• Transcript: Ll_transcript_484131
• CDS coordinates: 254-763 (+)
• Peptide sequence: MAWRNGCYDEVGHSKPLFLTIYIVVIIGIVVSSFYIFSAIYSSNPVASSSFSSISYDRPHLTDATLNISQLATVHTVPTPSLGPQNVWPKPIWDVPPHDKKMPPLEDFRLTKTLVQERVKDNVIIVTFGNYAFMDFILTWVKQLTDIGLSNLLVGEYSHLCHLSCPVFV*
• ORF Type: complete

Annotations of Ll_transcript_484131

• Blastp: Arabinosyltransferase XEG113 from Arabidopsis with 55.83% of identity
• Blastx: Arabinosyltransferase XEG113 from Arabidopsis with 81.25% of identity
• Eggnog: Nucleotide-diphospho-sugar transferase(ENOG410ZPDM)
• Kegg: Link to kegg annotations (AT2G35610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446950.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;