Protein coding transcript 716

• Transcript: Ll_transcript_435504
• CDS coordinates: 3-317 (+)
• Peptide sequence: NMVLLLGACPEYGCLVYEHMSRGSLDDVLFCRGNSPALPWQLRFKIVCEIGTGLLFLHQTKPEPLVHRDLKPANILLDRNYVAKISDVGLARLVPPSVANNVTQY
• ORF Type: internal

Annotations of Ll_transcript_435504

• Blastp: U-box domain-containing protein 34 from Arabidopsis with 61.9% of identity
• Blastx: U-box domain-containing protein 34 from Arabidopsis with 61.9% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G19410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447515.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;