Protein coding transcript 71615

• Transcript: Ll_transcript_484921
• CDS coordinates: 2261-2587 (+)
• Peptide sequence: MIMIFEFVFFNIDMPQISTKGLEFVHTSKVAKLLLASSPRLYNLINGAKQKATVVKVATDGKIIQRFDDDNGKVIRFVTSALEFEDHLYLGSLSSNFVGKLPLHNTSN*
• ORF Type: complete

Annotations of Ll_transcript_484921

• Blastp: Protein STRICTOSIDINE SYNTHASE-LIKE 10 from Arabidopsis with 35.29% of identity
• Blastx: Protein STRICTOSIDINE SYNTHASE-LIKE 6 from Arabidopsis with 42.31% of identity
• Eggnog: SMP-30 gluconolaconase LRE domain protein(COG3386)
• Kegg: Link to kegg annotations (AT3G57030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415167.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;