| Transcript | Ll_transcript_484929 |
|---|---|
| CDS coordinates | 124-477 (+) |
| Peptide sequence | MASNMILVVSSLVLSALVSLILQLFYFSPIDPLPLHILPASSSTNNHLQVKKSSYHIKELLYHSNIYVLFEQRFTYTRSCSTVKLLLSHYEITSSNLGNSLSACMDEATYIYPPRPS* |
| ORF Type | complete |
| Blastp | ATP-dependent DNA helicase Q-like 3 from Arabidopsis with 42.86% of identity |
|---|---|
| Blastx | ATP-dependent DNA helicase Q-like 3 from Arabidopsis with 42.86% of identity |
| Eggnog | atp-dependent dna helicase(COG0514) |
| Kegg | Link to kegg annotations (AT4G35740) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415167.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer