Protein coding transcript 71634

• Transcript: Ll_transcript_484617
• CDS coordinates: 163-642 (+)
• Peptide sequence: MLLALGNNNNNAYSIDHQNRIFHSSSLMLKTETINLGWKKRYRTKFSQEQKEKMFSFSEKLGWIMQKGDSGSVQEFCNEIGVPRGVFKVWMHNNKNTSRKKSENANPQIGNNNGGSEDGNVNGDGINNSFNINSSNNNDIQKNEDNCVDVHVSFNALSS*
• ORF Type: complete

Annotations of Ll_transcript_484617

• Blastp: Zinc-finger homeodomain protein 8 from Arabidopsis with 63.24% of identity
• Blastx: Zinc-finger homeodomain protein 8 from Arabidopsis with 63.24% of identity
• Eggnog: homeobox protein(ENOG410YKTX)
• Kegg: Link to kegg annotations (AT5G15210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422856.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;