Transcript | Ll_transcript_484619 |
---|---|
CDS coordinates | 332-1366 (+) |
Peptide sequence | MDLTPTICKDTQTPPLTQPINLNPPKSLSFTNGTLKPHSSTTTASATVPPPSSIVVSYKECLKNHAASIGGHAIDGCGEFMASSTAIPTDPRSLICAACGCHRNFHRRDPQEPQPPPPTFLTCFYSTTPSSVTPTAPPPPPQLPHRAMSQSTSPSLSSSPSHSPSPISSTPSSPPPLSHVPPSSYAAPHMLLALGNNNNAYSIDYQNRNFHSSSLVLKTETINLSGKKRYRTKFSLEQKEKMFRFSEKLGWRMQKGDDRSVQEFCSEIGVPRGVFKVWMHNNKNTLRKKSESAPQIEKTNSDKEVGNGDGINNSFNINCSNNNDIHKNEDNCVDVHVSFNGLSS* |
ORF Type | complete |
Blastp | Zinc-finger homeodomain protein 9 from Arabidopsis with 38.02% of identity |
---|---|
Blastx | Zinc-finger homeodomain protein 8 from Arabidopsis with 52% of identity |
Eggnog | homeobox protein(ENOG410YKTX) |
Kegg | Link to kegg annotations (AT3G28920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433688.1) |
Pfam | ZF-HD protein dimerisation region (PF04770.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer