Transcript | Ll_transcript_484621 |
---|---|
CDS coordinates | 287-1330 (+) |
Peptide sequence | MDLTPTTGTDTQTPPPTQPIKLNPSKSLSFTNGTLKPHTTVVPPPSQPPYMVVSYKECLKNHAASIGGHALDGCGEFMPSSTTNPTDPRSLKCAACGCHRNFHRRDPQEHHQQQQPPQPNFLTCFYSTTPSSVTPTAPPPQPPPPQLPHRAMSQSTSPSLSSSPSHSHSPMSSTPSSPPPLSHVPPSYSAPHMLLSLGNNNNAYSIDHQNRNFHSSSLVMRTETINLSGKKRYRTKFSQEQKEKMFSFSEKLGWRMQKSDDGSVQEFCNDIGVPRGVFKVWMHNNKNTLRKKSEVGNDGTPPQIEKTNVNGDDINNSFNINSSSNNDIHKNEDNCVDVHVSFNGLPS* |
ORF Type | complete |
Blastp | Zinc-finger homeodomain protein 11 from Arabidopsis with 47.11% of identity |
---|---|
Blastx | Zinc-finger homeodomain protein 8 from Arabidopsis with 59.77% of identity |
Eggnog | homeobox protein(ENOG410YKTX) |
Kegg | Link to kegg annotations (AT1G69600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445943.1) |
Pfam | ZF-HD protein dimerisation region (PF04770.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer