Protein coding transcript 71679

• Transcript: Ll_transcript_482626
• CDS coordinates: 779-1297 (+)
• Peptide sequence: MGYKMWLALPLIWDVLSNKEVVDIVAAAPSRSSAARAVVESAVRAWRYKYPTSKVDDCAVVCLFLDSDLHPMSSASNAKSNERPISADQVSSPGGAVSGPTILKGSATCRASNDTSLGESNDEVSKEEEIDAESEKDWSALEGVSRVNTLLNLPRFVPDKDDKAAAGMRKRK*
• ORF Type: complete

Annotations of Ll_transcript_482626

• Blastp: Probable protein phosphatase 2C 33 from Arabidopsis with 55.7% of identity
• Blastx: Probable protein phosphatase 2C 33 from Arabidopsis with 84.15% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G02750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431642.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;