Protein coding transcript 71681

• Transcript: Ll_transcript_482615
• CDS coordinates: 1578-2039 (+)
• Peptide sequence: MVAKRVRDSLPLKLNAHWEHCVSGDEVLKEITVNAAGSMNSEEAAIVSADEESRTSIDAEESTKHPEIFQTLKQSFLKAFKVMDRELKTHQSIDCFCSGTTAVTLVKQGRHLIIGNVGDSRAVMGTRAKDDSIVAVQLTVDLKPNLPGILLFW*
• ORF Type: complete

Annotations of Ll_transcript_482615

• Blastp: Probable protein phosphatase 2C 33 from Arabidopsis with 62.42% of identity
• Blastx: Probable protein phosphatase 2C 33 from Arabidopsis with 63.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G02750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431642.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;