Protein coding transcript 717

• Transcript: Ll_transcript_435508
• CDS coordinates: 3-380 (+)
• Peptide sequence: FFLLESKGDLSYLESFCGVLCLLFFCTLFSLPRDRSAKRERARRRKGQTLRPNPNGNEQQRNDKMRCSGHPHLERRVEGFGPVAFPVPPSSGGACVGGVPPEPEIGLEALALPTSRLLMAVGHDYH
• ORF Type: internal

Annotations of Ll_transcript_435508

• Blastp: Cytochrome c biogenesis CcmF C-terminal-like mitochondrial protein from Arabidopsis with 84.62% of identity
• Blastx: Cytochrome c biogenesis CcmF C-terminal-like mitochondrial protein from Arabidopsis with 84.62% of identity
• Eggnog: cytochrome c biogenesis(ENOG410YDS3)
• Kegg: Link to kegg annotations (ArthMp017)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013443282.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;