Transcript | Ll_transcript_484808 |
---|---|
CDS coordinates | 109-417 (+) |
Peptide sequence | MHDFCFTIPYGLVLVFGGIIGYINKGSIASLSGGAVSGFILIFASYLSLNAFRNRKNSYFAITLETSTFRVLIILPYLLVFSFCNNFSVIKCDGFFFVKGVI* |
ORF Type | complete |
Blastp | Protein FATTY ACID EXPORT 6 from Arabidopsis with 60.61% of identity |
---|---|
Blastx | Protein FATTY ACID EXPORT 6 from Arabidopsis with 60.61% of identity |
Eggnog | Transmembrane protein 14A(ENOG4112205) |
Kegg | Link to kegg annotations (AT3G20510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435534.1) |
Pfam | Transmembrane proteins 14C (PF03647.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer