Protein coding transcript 71818

• Transcript: Ll_transcript_483136
• CDS coordinates: 307-1095 (+)
• Peptide sequence: MNSHRMKKRQTLQHPNKEPTHPILFGFREPKMDHRIPKLGSFRHSFAERKERLLSMKSDGYSQIGIGLPESDEESNGPVARRWWRRCSDGVVMGWNKMKHVATSAWQLGQSDPRKIIFSVKMGLALTIISLLIFLKEPLKDVSRYFVWAILTVVLTFEYNIGSTFSKGLNRAAGTLSAAGIALGMSELSKLAGEWEEVAIIICIFLVGFCGTYLKFYPSMKAYEYGLRVFLITYCIVIVSGNRTGDFINPARNRFLLIALGAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_483136

• Blastp: Aluminum-activated malate transporter 9 from Arabidopsis with 54.94% of identity
• Blastx: Aluminum-activated malate transporter 9 from Arabidopsis with 54.7% of identity
• Eggnog: aluminum-activated malate transporter(ENOG410XR8V)
• Kegg: Link to kegg annotations (AT3G18440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436668.1)
• Pfam: Aluminium activated malate transporter (PF11744.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;