Protein coding transcript 71846

• Transcript: Ll_transcript_353848
• CDS coordinates: 237-1283 (+)
• Peptide sequence: MAPKSKAAKTSAASSPASTPFKPGFAVEVSSDDHGFRGSWFTGKIIRRVANNQFLIEYDNLMEDDSGSKRLREVLNLHQLRPVLPTETGREFKFGDEVDAYHNDGWWEGHITEECGDGRFAVYFRVSREQIVFQKEELRLHREWFNEVWVPPFEQQQQQQQEQEKVLTPAVKSAETVTPVVKPSKTVTPNVKSSKTVTPNVKPVKIVTEERFSVGTPVEVSSDEEGFQGAWFSATVVQVIGKGKFLVEYQSLLADDGSQLLREEVDTYHIRPHPPQTVDGHFSLLEEVDAFHNDGWWVGMVSKFLDNSRYVVYFRNSSEELEFEHSQLRKHQDWIDGKWIVASKVLEL*
• ORF Type: complete

Annotations of Ll_transcript_353848

• Blastp: DUF724 domain-containing protein 3 from Arabidopsis with 29.32% of identity
• Blastx: DUF724 domain-containing protein 3 from Arabidopsis with 29.45% of identity
• Eggnog: Protein of unknown function (DUF724)(ENOG410YXA1)
• Kegg: Link to kegg annotations (AT1G26540)
• CantataDB: -
• Mirbase: ppe-MIR6295 (MI0021668)
• Ncbi protein: Link to NCBI protein (XP_019452285.1)
• Pfam: Agenet domain (PF05641.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;