Protein coding transcript 71895

• Transcript: Ll_transcript_354299
• CDS coordinates: 136-927 (+)
• Peptide sequence: MDFGTVRNKLDGELYAYLEQFENDLFLICSNAMQYNSPDTIYHRQARAMQEIAKKDFENLRQDSDSDSEPQPKPQDKIVQRGRPPGKNISKSLPMSPSNRVAPESSSDATLASGGDIASGSNGYNLRKALSRFQPADSSARASHDNLNSGGYTSWSYDWENEFPASILKAVLRYGKKQSVVDETRRDTYNHPVTLRNEPPLVATVENEFKQLLAVGLHVKHGYARSVAHFAADLSPVAWKIVARKINSVLPPGHEFGPGWVAED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_354299

• Blastp: Bromodomain and PHD finger-containing protein 3 from Homo with 40.91% of identity
• Blastx: Bromodomain and PHD finger-containing protein 3 from Homo with 41.25% of identity
• Eggnog: bromodomain(COG5076)
• Kegg: Link to kegg annotations (27154)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417398.1)
• Pfam: Bromodomain (PF00439.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;