Protein coding transcript 71919

• Transcript: Ll_transcript_352821
• CDS coordinates: 111-773 (+)
• Peptide sequence: MQNMKRKREGEAGMDIVWQTPANPPHPQDYIFRNGTRYVKPYYFEFIAHVKNRWAGKTIVDLFADEFKGRPYEYYVSAVKCGRIQVDGGMVPVSYMVKSSQKISHFVHRHEPPVMACVVPILQKEPDVLTVCKPASVPVHPCGQYRKNTVVGILEAEHGLAPLFPIHRLDRLVSGLLILARNASKADMFRQQIEGGLVKKQYIAKVVGEFPKDELIVDANI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_352821

• Blastp: RNA pseudouridine synthase 7 from Oryza sativa with 75.94% of identity
• Blastx: RNA pseudouridine synthase 7 from Oryza sativa with 75.94% of identity
• Eggnog: pseudouridine synthase activity(COG0564)
• Kegg: Link to kegg annotations (9269812)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417833.1)
• Pfam: RNA pseudouridylate synthase (PF00849.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;