Transcript | Ll_transcript_352836 |
---|---|
CDS coordinates | 1856-2200 (+) |
Peptide sequence | MIISAIHRLDRLVSGLLILARNASKADMFRQQIEGGLVKKQYIAKVVGEFPKDELIVDANIDYNAREGRSTAEVRDSAKGKTASTKFNRISSNGTQSIVLCEPVTGRTHQARNS* |
ORF Type | complete |
Blastp | RNA pseudouridine synthase 7 from Arabidopsis with 71.68% of identity |
---|---|
Blastx | RNA pseudouridine synthase 7 from Arabidopsis with 71.05% of identity |
Eggnog | pseudouridine synthase activity(COG0564) |
Kegg | Link to kegg annotations (AT5G51140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417834.1) |
Pfam | RNA pseudouridylate synthase (PF00849.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer