Protein coding transcript 71922

• Transcript: Ll_transcript_352837
• CDS coordinates: 1864-2208 (+)
• Peptide sequence: MIISAIHRLDRLVSGLLILARNASKADMFRQQIEGGLVKKQYIAKVVGEFPKDELIVDANIDYNAREGRSTAEVRDSAKGKTASTKFNRISSNGTQSIVLCEPVTGRTHQARNS*
• ORF Type: complete

Annotations of Ll_transcript_352837

• Blastp: RNA pseudouridine synthase 7 from Arabidopsis with 71.68% of identity
• Blastx: RNA pseudouridine synthase 7 from Arabidopsis with 71.05% of identity
• Eggnog: pseudouridine synthase activity(COG0564)
• Kegg: Link to kegg annotations (AT5G51140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417834.1)
• Pfam: RNA pseudouridylate synthase (PF00849.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;