Protein coding transcript 71926

• Transcript: Ll_transcript_352813
• CDS coordinates: 245-1078 (+)
• Peptide sequence: MDSHDKPVVLITGCSHGGIGHALARAFASNNCLVVATSRSRSSMADMEKDERVILEELDVKSDESVREVIEHVIHKFGRIDVLVNNAGVQCVGPLSEIPLSQIQSTFDTNVFGSLRMVQAVVPHMATRKKGKIVNIGSVAALASGPWSGAYTSSKAALHALTDTLRMELSHFGIDVINVVPGAIKSNIGKAAIAGYNRMPEWKLFKPFEAAIRERAYLSQTSKSTPTDEFARNTVAVVLKKNPPAWFSYGQYSTAMAIMYHLPLSIRDFILKKALKC*
• ORF Type: complete

Annotations of Ll_transcript_352813

• Blastp: NADPH-dependent 1-acyldihydroxyacetone phosphate reductase from Schizosaccharomyces with 36.12% of identity
• Blastx: NADPH-dependent 1-acyldihydroxyacetone phosphate reductase from Schizosaccharomyces with 36.12% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC23D3.11)
• CantataDB: Link to cantataDB annotations (CNT0000200)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437605.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;