Transcript | Ll_transcript_352841 |
---|---|
CDS coordinates | 245-760 (+) |
Peptide sequence | MDSHDKPVVLITGCSHGGIGHALARAFASNNCLVVATSRSRSSMADMEKDERVILEELDVKSDESVREVIEHVIHKFGRIDVLVNNAGVQCVGPLSEIPLSQIQSTFDTNVFGSLRMVQAVVPHMATRKKGKIVNIGSVAALASGPWSGAYTSSKAALHALTDTLRFSSSY* |
ORF Type | complete |
Blastp | NADPH-dependent 1-acyldihydroxyacetone phosphate reductase from Schizosaccharomyces with 41.25% of identity |
---|---|
Blastx | NADPH-dependent 1-acyldihydroxyacetone phosphate reductase from Schizosaccharomyces with 41.25% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC23D3.11) |
CantataDB | Link to cantataDB annotations (CNT0000200) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437605.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer