Protein coding transcript 71930

• Transcript: Ll_transcript_352834
• CDS coordinates: 1633-2454 (+)
• Peptide sequence: MDGGNEVHMVSSTQAPQKHQKYVSHVLGLPMSKVVCKTKRIGGGFGGKETRSAFIAAAASVPAYLLNRPVKITLDRDVDMMITGQRHSFLGKYKVGFTNEGRVLALDLEIYNNAGNSLDLSLAILERAMFHSDNVYEIPNMRIIGRACFTNFPSHTAFRGFGGPQGMLITENWIQRIAMELKMSPEKIREINFQGEGSVTHYGQQLQYCTLAQLWNELKLSCDFVKAREEVDQFNAHNRWKKRGIAMVPNKFGISFTTKLMNQVILQFIVLFC*
• ORF Type: complete

Annotations of Ll_transcript_352834

• Blastp: Xanthine dehydrogenase 1 from Arabidopsis with 84.79% of identity
• Blastx: Xanthine dehydrogenase 1 from Arabidopsis with 83.38% of identity
• Eggnog: xanthine dehydrogenase(COG4630)
• Kegg: Link to kegg annotations (AT4G34890)
• CantataDB: Link to cantataDB annotations (CNT0001190)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448314.1)
• Pfam: Molybdopterin-binding domain of aldehyde dehydrogenase (PF02738.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;