| Transcript | Ll_transcript_353702 |
|---|---|
| CDS coordinates | 802-1104 (+) |
| Peptide sequence | MQLELQYAAETNALQPPHTFVPWVVVDGKPLSEDYRNFLSYVCEAYKGTDTPQSCTKEYLNSVPKGEATPKHFVSHMKRMIPTWELVWSTITSWMEIMNF* |
| ORF Type | complete |
| Blastp | Gamma-interferon-inducible lysosomal thiol reductase from Rattus with 56.52% of identity |
|---|---|
| Blastx | Gamma-interferon-inducible lysosomal thiol reductase from Rattus with 56.52% of identity |
| Eggnog | Lysosomal thiol(ENOG4111IDT) |
| Kegg | Link to kegg annotations (290644) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435516.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer