Transcript | Ll_transcript_353703 |
---|---|
CDS coordinates | 1-447 (+) |
Peptide sequence | PNFLFKLANCFRTSLSCNYEVRTNIAVAEIASQVPYCSNTKFITLLRLKAMVSSTTTLSLLSYLFFFSLFSPSQSHKVSLELYYESLCPYSANFIVNYLPKIFSDDLLPIVDVTLIPWGNAKLKTNNNFTCQVLSLHLTNITHFFCSL* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | GILT-like protein 2 from Sophophora with 42.11% of identity |
Eggnog | Lysosomal thiol(ENOG4111IDT) |
Kegg | Link to kegg annotations (Dmel_CG10157) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435516.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer