Protein coding transcript 71945

• Transcript: Ll_transcript_353705
• CDS coordinates: 3-536 (+)
• Peptide sequence: AKLNGNNNFTCQHGPYECLLNTVEACAINIWPELNFPFIYCIETLVYEHKQKEWESCFDKLGLDPEPIDQCYNGEYGKELELEYAAQTNALQPPHKYVPWVVVDGKPLYEDYENFLSYVCNAYKGTDTPQSCTKAYLNAVPKGEAKPNNLVCHMKRMIPTWEKVRSTITSWMQKMNF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_353705

• Blastp: Gamma-interferon-inducible lysosomal thiol reductase from Rattus with 43.7% of identity
• Blastx: Gamma-interferon-inducible lysosomal thiol reductase from Rattus with 43.7% of identity
• Eggnog: Lysosomal thiol(ENOG4111IDT)
• Kegg: Link to kegg annotations (290644)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418104.1)
• Pfam: Gamma interferon inducible lysosomal thiol reductase (GILT) (PF03227.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;