Protein coding transcript 71951

• Transcript: Ll_transcript_353699
• CDS coordinates: 1272-1640 (+)
• Peptide sequence: MDFESIIILWLKILSQVVFTIFMQLELQYAAETNALQPPHTFVPWVVVDGKPLSEDYRNFLSYVCEAYKGTDTPQSCTKEYLNSVPKGEATPKHFVSHMKRMIPTWELVWSTITSWMEIMNF*
• ORF Type: complete

Annotations of Ll_transcript_353699

• Blastp: Gamma-interferon-inducible lysosomal thiol reductase from Rattus with 56.52% of identity
• Blastx: Gamma-interferon-inducible lysosomal thiol reductase from Rattus with 56.52% of identity
• Eggnog: Lysosomal thiol(ENOG4111IDT)
• Kegg: Link to kegg annotations (290644)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435516.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;