Transcript | Ll_transcript_353585 |
---|---|
CDS coordinates | 190-867 (+) |
Peptide sequence | MLQRWSKAITHVSKIGSLSNLKFVSDVCVGTRHSYAKVAAAAAPTIEDKGLTREPVVNLDKMFWSKPCSLALARDSPLRVEEPNYEGIKRFILRLMMFYSKQSKSIRGANVVYRRIVSQVDKPPIYEVFNLEKTFKTTFSLLVLHMWLCLRRLKQDGKEGVEFGQYLYEIYNHDVELRVSKAGVNLLLSKWMKDLEKIFYGNIVAYDTAMLPEAKQGDLSNVIWK* |
ORF Type | complete |
Blastp | Ubiquinol-cytochrome-c reductase complex assembly factor 1 from Xenopus with 28.7% of identity |
---|---|
Blastx | Ubiquinol-cytochrome-c reductase complex assembly factor 1 from Xenopus with 28.81% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445558.1) |
Pfam | Ubiquinol-cytochrome C chaperone (PF03981.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer