Protein coding transcript 71958

• Transcript: Ll_transcript_353566
• CDS coordinates: 190-984 (+)
• Peptide sequence: MLQRWSKAITHVSKIGSLSNLKFVSDVCVGTRHSYAKVAAAAAPTIEDKGLTREPVVNLDKMFWSKPCSLALARDSPLRVEEPNYEGIKRFILRLMMFYSKQSKSIRGANVVYRRIVSQVDKPPIYEVFNLEKTFKTTFSLLVLHMWLCLRRLKQDGKEGVEFGQYLYEIYNHDVELRVSKAGVNLLLSKWMKDLEKIFYGNIVAYDTAMLPEAKQGDLSNVIWKNIFSDDGTSTPDAAALHSVQAMARYARLQASCMSLTGIE*
• ORF Type: complete

Annotations of Ll_transcript_353566

• Blastp: Ubiquinol-cytochrome-c reductase complex assembly factor 1 from Xenopus with 28.57% of identity
• Blastx: Ubiquinol-cytochrome-c reductase complex assembly factor 1 from Xenopus with 28.57% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445558.1)
• Pfam: Ubiquinol-cytochrome C chaperone (PF03981.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;