Protein coding transcript 71974

• Transcript: Ll_transcript_354664
• CDS coordinates: 206-775 (+)
• Peptide sequence: MQQNLQNVCLKTGAPMESHAATILTPFAFSKLQEQLVLAAHYASFPIEDGFLVRHHTKAEGGRKVYWAPQEGIISCSCHQFDFSGILCRHSLRVLSTGNCFQIPDRYLPIRWRRISMPSSKLLQSAPNDHAERVQLLQNMVSSLITESAKSKERLDIATEQVSNLLSRIREQPISLQGVKDVSSINRNV*
• ORF Type: complete

Annotations of Ll_transcript_354664

• Blastp: Protein FAR1-RELATED SEQUENCE 11 from Arabidopsis with 76.19% of identity
• Blastx: Protein FAR1-RELATED SEQUENCE 11 from Arabidopsis with 73.09% of identity
• Eggnog: protein FAR1-RELATED SEQUENCE(ENOG410YDZ2)
• Kegg: Link to kegg annotations (AT1G10240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440413.1)
• Pfam: SWIM zinc finger (PF04434.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;