Protein coding transcript 72047

• Transcript: Ll_transcript_354066
• CDS coordinates: 710-1219 (+)
• Peptide sequence: MPAGRVGAKRDFGFIHYAERSSALEAIKDTEKYEIDGQELEVVLAKPQAEKKHDGGYAYNPGFHSNHPPHPAYGAFSGNLYGSGEGGYGVSAGYHQPMIYGRGPMPVGMQMVPMVLPDGQIGYVLQQPGVQGPPARPRRNDRNDGRNGHGRRGGDGNDDGNRSRRYRPY*
• ORF Type: complete

Annotations of Ll_transcript_354066

• Blastp: Heterogeneous nuclear ribonucleoprotein Q from Arabidopsis with 60.12% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein Q from Arabidopsis with 64.5% of identity
• Eggnog: RNA binding motif protein(ENOG410XTJ5)
• Kegg: Link to kegg annotations (AT4G00830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419245.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;