Protein coding transcript 72049

• Transcript: Ll_transcript_354082
• CDS coordinates: 710-1123 (+)
• Peptide sequence: MPAGRVGAKRDFGFIHYAERSSALEAIKDTEKYEIDGQELEVVLAKPQAEKKHDGGYAYNPGFHSNHPPHPAYGAFSGNLYGSGEGGYGVSAGYHQVLRDNLQRIFTINEFASWFIICSNLFASHGFLCTFEQPMIYG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_354082

• Blastp: Heterogeneous nuclear ribonucleoprotein Q from Arabidopsis with 52.53% of identity
• Blastx: Heterogeneous nuclear ribonucleoprotein Q from Arabidopsis with 66.67% of identity
• Eggnog: RNA binding motif protein(ENOG410XTJ5)
• Kegg: Link to kegg annotations (AT4G00830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419245.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;