| Transcript | Ll_transcript_353971 |
|---|---|
| CDS coordinates | 238-570 (+) |
| Peptide sequence | MLEAEKTNGIGKTENEVLLNLKTLSQNGFEKVMIRNKLDAVVVPGPNFSRILAIGGYPGVIVPAGYEKGVPFGISFAGLKGSEPNLIEIAYSFEQATKIRKPPPLQKLRA* |
| ORF Type | complete |
| Blastp | Glutamyl-tRNA(Gln) amidotransferase subunit A from Candidatus Desulforudis with 39.66% of identity |
|---|---|
| Blastx | - |
| Eggnog | Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (By similarity)(COG0154) |
| Kegg | Link to kegg annotations (Daud_1033) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431564.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer