Protein coding transcript 72061

• Transcript: Ll_transcript_353985
• CDS coordinates: 499-1101 (+)
• Peptide sequence: MLAPVDVFVSTVDPMKEPPLVTANTVLSILAMDYPVEKISCYISDDGASMCTFESLSETAEFARKWVPFCKKFSIEPRAPEMYFSEKVDYLKDKVQATFVKERRAMKREYEEFKVRINALVAKAQKVPEGGWIMQDGTPWPGNNTKDHPGMIQVFLGTSGGLDTEGNQLPRLVYVSREKRPGFQHHKKAGAMNALVRVSAV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_353985

• Blastp: Probable cellulose synthase A catalytic subunit 2 [UDP-forming] from Oryza sativa with 88.5% of identity
• Blastx: Probable cellulose synthase A catalytic subunit 2 [UDP-forming] from Oryza sativa with 85.98% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (4334515)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415364.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;