Protein coding transcript 72108

• Transcript: Ll_transcript_354344
• CDS coordinates: 1340-2308 (+)
• Peptide sequence: MQNGRKAYITYVIFVPDMKTNLSSLGQLHEKGFSMELHNGVMEISDSLKRTILSAPLLSNRTFQVKLSILDSQCLNADECWLWHLRYGHLNYKDLKLLSVKKLVTGLPEIKLQSKVCDSCLTSKQARTSFGNHSQTRAIDLLHVVYSDVCGPFEVPSLGGNRYFVSFADEFSRKIWIYLIKAKSEVFDHVKKLKALAERQSGKFLRIFRTGGGGEFTSKEIEEYCEGHGIIHEVTAPYTPHHNGVVKRKNKTVMNMVRCMLKSKDLPHNLWGEALTTTTYVLNRCPTQALAIQVAEEVWTGKKQPVRHFRVFVSLCYKHVPN*
• ORF Type: complete

Annotations of Ll_transcript_354344

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.08% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 35.63% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451907.1)
• Pfam: GAG-pre-integrase domain (PF13976.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;