Protein coding transcript 72120

• Transcript: Ll_transcript_355023
• CDS coordinates: 1-513 (+)
• Peptide sequence: PGDIVSIKLGDIIPADARLLEGDALSVDQSALTGESLPVTKHSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVGIVIELVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIAEM
• ORF Type: internal

Annotations of Ll_transcript_355023

• Blastp: ATPase 2, plasma membrane-type from Arabidopsis with 92.98% of identity
• Blastx: ATPase 2, plasma membrane-type from Arabidopsis with 92.98% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT4G30190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438801.1)
• Pfam: E1-E2 ATPase (PF00122.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;