Protein coding transcript 72209

• Transcript: Ll_transcript_354868
• CDS coordinates: 1851-2315 (+)
• Peptide sequence: MQQVKIFNHPDLQDGFGKAWNHSLLANIIEEEITTHSINMVITFDNYGVSGHCNHRDVHYGVCKVLYDTLQRDIEVWELVSNNILRKYSGPVDIWLSMLWPILLSNETMQCFVNENPRRSYLAMAQHASQWVWFRKLFVTLSSYTYVNTLRKIK*
• ORF Type: complete

Annotations of Ll_transcript_354868

• Blastp: Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase from Dictyostelium with 31.98% of identity
• Blastx: Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase from Dictyostelium with 31.98% of identity
• Eggnog: lmbE family(COG2120)
• Kegg: Link to kegg annotations (DDB_G0293136)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447785.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;