Transcript | Ll_transcript_354870 |
---|---|
CDS coordinates | 1712-2059 (+) |
Peptide sequence | MVITFDNYGVSGHCNHRDVHYGVCKVLYDTLQRDIEVWELVSNNILRKYSGPVDIWLSMLWPILLSNETMQCFVNENPRRSYLAMAQHASQWVWFRKLFVTLSSYTYVNTLRKIK* |
ORF Type | complete |
Blastp | Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase from Dictyostelium with 32.87% of identity |
---|---|
Blastx | Probable N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase from Dictyostelium with 30.99% of identity |
Eggnog | lmbE family(COG2120) |
Kegg | Link to kegg annotations (DDB_G0293136) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447785.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer