Protein coding transcript 72216

• Transcript: Ll_transcript_353873
• CDS coordinates: 3-347 (+)
• Peptide sequence: ALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLNRATSPLTGGSMKSTKEDKKEKEKEKSGQAEKEGQEEPALKTAGPEGEITAGFLLKKSAKTNGWSRP
• ORF Type: internal

Annotations of Ll_transcript_353873

• Blastp: Dynamin-2B from Arabidopsis with 75.83% of identity
• Blastx: Dynamin-2B from Arabidopsis with 73.33% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT1G59610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413444.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;