Protein coding transcript 72217

• Transcript: Ll_transcript_353875
• CDS coordinates: 3-605 (+)
• Peptide sequence: ALVDMERAFVPPQHFIRLVQRRMERQRREEELKGRSSKKGQDAEQSLLNRATSPLTGGSMKSTKEDKKEKEKDKSGQAEKEGQEGPALKTAGPEGEITAGFLLKKSAKTDGWSRRWFVLNEKTGKLGYTKKQEERHFRGVITLEECNIEEVPEEDPPSKSSKDKKSQGPDSGNVNLVFKITSRVPYKTVLKAHSAVVLKAE
• ORF Type: internal

Annotations of Ll_transcript_353875

• Blastp: Dynamin-2B from Arabidopsis with 76.92% of identity
• Blastx: Dynamin-2B from Arabidopsis with 71.15% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT1G59610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453390.1)
• Pfam: PH domain (PF00169.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;