| Transcript | Ll_transcript_353039 |
|---|---|
| CDS coordinates | 59-499 (+) |
| Peptide sequence | MKNSKIITETIISYYNMRPQSNTTTTTNINTFSDPSFSSSIHRRITTLSNHLLNPHMASDNQSISVSPTASSHSVFAHLLPAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEVTPILYLFFSFFVIFCVTKLSTSLSLAYHVRRV* |
| ORF Type | complete |
| Blastp | Aspartate aminotransferase 1 from Medicago with 84.21% of identity |
|---|---|
| Blastx | Aspartate aminotransferase 1 from Medicago with 84.21% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438405.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer