Protein coding transcript 72355

• Transcript: Ll_transcript_353052
• CDS coordinates: 808-1407 (+)
• Peptide sequence: MFFSFFLTGLLEDLGSAPSGSVVLLHACAHNPTGVDPTPEQWEHIRQLIRSKALLPFFDSAYQGFASGSLDTDAQPVRTFVADGGELLVAQSYAKNMGLYGERVGALSIVCKSADVASRVESQVKLVVRPMYSNPPIHGASIVAAILRDRNLYNEWTIELKAMADRIINMRQKLFDALRSRGTPGDWSHIIKQIGMFTFT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_353052

• Blastp: Aspartate aminotransferase 1 from Medicago with 92.19% of identity
• Blastx: Aspartate aminotransferase 1 from Medicago with 80.2% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438405.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;